DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and Tagln

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_035656.1 Gene:Tagln / 21345 MGIID:106012 Length:201 Species:Mus musculus


Alignment Length:198 Identity:73/198 - (36%)
Similarity:110/198 - (55%) Gaps:12/198 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAVTEEPINTSGDTDNFFEV-LKDGVILCKLA 66
            :|:....|.:.|.|.||..||.|||.:..:|||.......:.........|:| ||:||||.||.
Mouse     2 ANKGPSYGMSREVQSKIEKKYDEELEERLVEWIVVQCGPDVGRPDRGRLGFQVWLKNGVILSKLV 66

  Fly    67 NALQPGSIKKI----NESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQ 127
            |:|.|...|.:    |...|.||.||.::.||..|:::||...:.||:|||:|.:::.:|...|.
Mouse    67 NSLYPEGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLYEGKDMAAVQRTLM 131

  Fly   128 SLGRKASNFN------KPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGI-NFGNT 185
            :||..|...|      .|:...|:|.::.|:|:|.||:.|.:||.||.|||:||:|:|: .:|..
Mouse   132 ALGSLAVTKNDGNYRGDPNWFMKKAQEHKRDFTDSQLQEGKHVIGLQMGSNRGASQAGMTGYGRP 196

  Fly   186 RHM 188
            |.:
Mouse   197 RQI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 42/113 (37%)
Calponin 165..187 CDD:395325 11/22 (50%)
TaglnNP_035656.1 SCP1 14..189 CDD:227526 67/174 (39%)
CH 25..137 CDD:237981 40/111 (36%)
Calponin-like 175..200 12/25 (48%)
Calponin 175..198 CDD:278814 11/22 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834945
Domainoid 1 1.000 84 1.000 Domainoid score I8230
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4496
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm8680
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.