powered by:
Protein Alignment Chd64 and clik-2
DIOPT Version :9
Sequence 1: | NP_647860.1 |
Gene: | Chd64 / 38490 |
FlyBaseID: | FBgn0035499 |
Length: | 188 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509299.1 |
Gene: | clik-2 / 181031 |
WormBaseID: | WBGene00016898 |
Length: | 397 |
Species: | Caenorhabditis elegans |
Alignment Length: | 49 |
Identity: | 14/49 - (28%) |
Similarity: | 28/49 - (57%) |
Gaps: | 8/49 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 140 SIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGI-NFGNTRH 187
::|.|:.::.::..|: .::.||.|:||.|:|.|: .||..|:
Worm 237 TVGGKDIEEELKQKSE-------GIVPLQSGTNKLASQRGMTGFGTPRN 278
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D861989at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.