DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and clik-2

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_509299.1 Gene:clik-2 / 181031 WormBaseID:WBGene00016898 Length:397 Species:Caenorhabditis elegans


Alignment Length:49 Identity:14/49 - (28%)
Similarity:28/49 - (57%) Gaps:8/49 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 SIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGI-NFGNTRH 187
            ::|.|:.::.::..|:       .::.||.|:||.|:|.|: .||..|:
 Worm   237 TVGGKDIEEELKQKSE-------GIVPLQSGTNKLASQRGMTGFGTPRN 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120
Calponin 165..187 CDD:395325 10/22 (45%)
clik-2NP_509299.1 Calponin 29..52 CDD:278814
Calponin 73..95 CDD:278814
Calponin 257..277 CDD:278814 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D861989at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.