DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and cpn-2

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_493713.2 Gene:cpn-2 / 173424 WormBaseID:WBGene00000778 Length:203 Species:Caenorhabditis elegans


Alignment Length:196 Identity:75/196 - (38%)
Similarity:108/196 - (55%) Gaps:10/196 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAVTEE----PINTSGDTDNFFEVLKDGVILC 63
            :|.....|.:.|.|:|.::::..|.|.|.|:||:.||.|    .:.|...:.:...:|||||:||
 Worm     2 ANHGPSYGLSRELQKKNDARFVLEEAIEVLKWIENVTGERFSFDVTTCESSTDVSNLLKDGVMLC 66

  Fly    64 KLANALQPGSIKKINES-KMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQ 127
            ||...|.|......|:. ||||..|||||.|||.||.|||.....||:|||:|.:....|:.||:
 Worm    67 KLIEKLDPSCRVVYNKKPKMAFPMMENISNFLAAAKQFGVMEISCFQTVDLYENKQCYKVIECLR 131

  Fly   128 SLG----RKASNFNKPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGIN-FGNTRH 187
            .|.    .::|:...|:...|.|..:.|.|.:..:|.|..||.||||:||.|:|.|:: :|..|.
 Worm   132 LLAAVAQSRSSHLEHPAWVVKLAQSSPRQFPEAVMRRGEMVIPLQYGTNKCASQKGMSPYGLPRQ 196

  Fly   188 M 188
            :
 Worm   197 I 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 49/117 (42%)
Calponin 165..187 CDD:395325 11/22 (50%)
cpn-2NP_493713.2 SCP1 14..187 CDD:227526 69/172 (40%)
CH 25..133 CDD:278723 48/107 (45%)
Calponin 173..196 CDD:278814 11/22 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56098
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.