DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and cpn-4

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_492849.3 Gene:cpn-4 / 172996 WormBaseID:WBGene00000780 Length:154 Species:Caenorhabditis elegans


Alignment Length:147 Identity:62/147 - (42%)
Similarity:87/147 - (59%) Gaps:4/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAVTEEPINTSGDTDNFFEVLKDGVILCKLANA 68
            :|...:|.|.....|..||:::..|...||||:.:|:|..:.....|||.|.||||..||||.||
 Worm     6 HRPRPAGMAGAILDKQASKFNDVEAGYLLEWIRDLTKEDFDCEASRDNFREQLKDGQRLCKLVNA 70

  Fly    69 LQPGSIKKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQSLGRKA 133
            ::.||:|||.:....|.|:|||:.|...|::.||..:||||||||::.::|.||.:.||||.||.
 Worm    71 IKAGSVKKIMKPISNFNCLENINQFSTAARSLGVKDEETFQSVDLFDGRDLFSVTVTLQSLARKV 135

  Fly   134 SNFN-KPSIGPKEADKN 149
            .... .|   ||:..|:
 Worm   136 EKLGITP---PKQVSKD 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 51/108 (47%)
Calponin 165..187 CDD:395325
cpn-4NP_492849.3 CH 33..134 CDD:366016 49/100 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I3846
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.