DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and cpn-1

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001369984.1 Gene:cpn-1 / 172660 WormBaseID:WBGene00000777 Length:192 Species:Caenorhabditis elegans


Alignment Length:188 Identity:107/188 - (56%)
Similarity:138/188 - (73%) Gaps:2/188 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASNRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAVTEEPINTSGDTDNFFEVLKDGVILCKLA 66
            :|:||.|||.|.|||:||..||.:.||.|.|:|::.||.:..:|.||.||..:|.:||.:||.||
 Worm     6 SSDRAEKSGIALEAQQKIYEKYDKNLAGEILQWVQNVTGQSFDTQGDADNLVKVFQDGSLLCTLA 70

  Fly    67 NALQPGSIKKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQSLGR 131
            |:|:|||:||:|.|.||||.|||||.||..|:.: |...|.||:|||:|.|:.|:|:|||.||.|
 Worm    71 NSLKPGSVKKVNTSAMAFKKMENISFFLKFAEEY-VQKSELFQTVDLYEGQDPNAVLICLASLAR 134

  Fly   132 KA-SNFNKPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGINFGNTRHM 188
            |: .||.:..:|||||..:.|.::||||:||.|||.||.|||||||.||:|.||||||
 Worm   135 KSEKNFGRSGLGPKEAQGDRREWTDEQLKAGHNVIGLQMGSNKGATASGLNMGNTRHM 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 58/108 (54%)
Calponin 165..187 CDD:395325 16/21 (76%)
cpn-1NP_001369984.1 CH_dMP20-like 26..134 CDD:409056 58/108 (54%)
Calponin 169..191 CDD:395325 16/21 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166920
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 207 1.000 Inparanoid score I2415
Isobase 1 0.950 - 0 Normalized mean entropy S1711
OMA 1 1.010 - - QHG56098
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - oto17217
orthoMCL 1 0.900 - - OOG6_102866
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.690

Return to query results.
Submit another query.