DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and unc-87

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001021092.1 Gene:unc-87 / 172397 WormBaseID:WBGene00006819 Length:565 Species:Caenorhabditis elegans


Alignment Length:203 Identity:49/203 - (24%)
Similarity:74/203 - (36%) Gaps:41/203 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RKINSKYSEELAQESLEWIKAVTEEPINTSGDTDNFF------------EVLKDGVILCKLANAL 69
            |..|::...|..||..|.|...|...:.....|:.:.            :|.::||.:     |.
 Worm   259 RNTNTRVKSENLQEIPEDIANRTHGEVRLQSGTNKYCSQRGMTGFGSGRDVCREGVRV-----AQ 318

  Fly    70 QPGSIKKINESKMAFKCMENISAFLACAK---------NFGVPTQETFQSVDL----WERQNLNS 121
            .|..:.::.|.|:  :..|.|....|...         .||...:||.:.||.    ::.:..:.
 Worm   319 NPADLAELPEEKI--RMSEGIVRLQAGTNKYDSQKGMTGFGTGRRETTKMVDSKHPEYDHEKPDQ 381

  Fly   122 VVICLQSLGRK-ASNFNKPSIG------PKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSG 179
            ..|.|||...| ||.......|      .|..|.|..::|.| .......|..|.|||:.|:|.|
 Worm   382 SEIPLQSGTNKFASQKGMTGFGTARRETTKMVDSNHPDYSHE-CSIDQTTIPSQMGSNQYASQKG 445

  Fly   180 I-NFGNTR 186
            : .||..|
 Worm   446 MTGFGQPR 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 27/133 (20%)
Calponin 165..187 CDD:395325 11/23 (48%)
unc-87NP_001021092.1 Calponin 286..307 CDD:278814 1/20 (5%)
Calponin 339..360 CDD:278814 3/20 (15%)
Calponin 384..406 CDD:278814 8/21 (38%)
Calponin 434..454 CDD:278814 10/20 (50%)
Calponin 473..494 CDD:278814
Calponin 520..539 CDD:278814
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D861989at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.