DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and Cnn2

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_031751.1 Gene:Cnn2 / 12798 MGIID:105093 Length:305 Species:Mus musculus


Alignment Length:189 Identity:72/189 - (38%)
Similarity:106/189 - (56%) Gaps:9/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAVTEEPINTSGDTDNFFEVLKDGVILCKLANA 68
            |:....|.:||.:.::.|||..:...|...||:.:|...|.     .:|.:.||||||||.|.|.
Mouse     7 NKGPSYGLSAEVKNRLLSKYDPQKEAELRSWIEGLTGLSIG-----PDFQKGLKDGVILCTLMNK 66

  Fly    69 LQPGSIKKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQSLGRKA 133
            |||||:.|||.|...:..:||:|.|:....::|:...:.|::.||:|..|:..|.:.|.:|..||
Mouse    67 LQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKA 131

  Fly   134 SNFNKPS---IGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGIN-FGNTRHM 188
            ......|   ||.|.::|..|||.|..::||..||.||.|:||.|:|||:. :|..||:
Mouse   132 KTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 40/108 (37%)
Calponin 165..187 CDD:395325 11/22 (50%)
Cnn2NP_031751.1 SCP1 19..190 CDD:227526 67/175 (38%)
CH 31..127 CDD:278723 37/100 (37%)
Calponin-like 1 166..191 13/25 (52%)
Calponin 166..189 CDD:278814 11/22 (50%)
Calponin-like 2 206..231
Calponin 206..229 CDD:278814
Calponin-like 3 245..269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834939
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.