DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and CNN2

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001290430.1 Gene:CNN2 / 1265 HGNCID:2156 Length:330 Species:Homo sapiens


Alignment Length:210 Identity:70/210 - (33%)
Similarity:108/210 - (51%) Gaps:30/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAVTEEPINTSGDTDNFFEVLKDGVILCKLANA 68
            |:....|.:||.:.::.|||..:...|...||:.:|...|.     .:|.:.||||.|||.|.|.
Human     7 NKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIG-----PDFQKGLKDGTILCTLMNK 66

  Fly    69 LQPGSIKKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQSLGRKA 133
            |||||:.|||.|...:..:||:|.|:....::|:...:.|::.||:|..|:..|.:.|.:|..|.
Human    67 LQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKG 131

  Fly   134 SN---------FNKP---------------SIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKG 174
            .:         :::|               .||.|.::|..|||.|..::||..||.||.|:||.
Human   132 LDLGSLAALCWYSRPLSLTQAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKC 196

  Fly   175 ATQSGIN-FGNTRHM 188
            |:|||:. :|..||:
Human   197 ASQSGMTAYGTRRHL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 39/108 (36%)
Calponin 165..187 CDD:395325 11/22 (50%)
CNN2NP_001290430.1 Calponin 19..211 CDD:332521 65/196 (33%)
Calponin 227..250 CDD:306832
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144831
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.