DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack and Shark

DIOPT Version :9

Sequence 1:NP_647859.1 Gene:Ack / 38489 FlyBaseID:FBgn0028484 Length:1073 Species:Drosophila melanogaster
Sequence 2:NP_524743.2 Gene:Shark / 44353 FlyBaseID:FBgn0015295 Length:939 Species:Drosophila melanogaster


Alignment Length:436 Identity:137/436 - (31%)
Similarity:199/436 - (45%) Gaps:94/436 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STSAVDGGLGSETAWLEDLLR--------EVQLEQFLDRIRDDLQVTRLAHFDYVLPDDLERCGL 59
            ||...||..||..|...::..        |:.|.....:..        |..:|....|:     
  Fly   527 STFNADGVTGSGAAAAGEVYNVPRNNTPIEIDLPPIAQKTE--------AEVEYFTKSDV----- 578

  Fly    60 GKPAIRRLMEAVRKKKAHQWRKNILSKLIGGGKQPSSK---------KQSSAARESSQG------ 109
                      |:.:::|.||        ||.|.||:..         |..:.||.:|.|      
  Fly   579 ----------AIERERAGQW--------IGNGYQPTMDVLSLLDQQIKAPAVARLNSLGPNASTE 625

  Fly   110 -----------NGT------------QLTCLIHEKDITMGLKLGDGSFGVVRRGEW--SASPAGK 149
                       :||            :|...|..:.:.:..::|.|.||.|..| |  ..|.||:
  Fly   626 SEMASYLHRKCSGTPSTPSATEVEAAKLRFFIEPEKLVLDREIGHGEFGSVHSG-WLLRKSGAGE 689

  Fly   150 V--IPVAVKVLKSDNLTQPGIIDDFFREVQAMHALDHANLVRLYGVVLSQPMMMITELAERGS-- 210
            .  :.||:|:|..::..:    .:|.||...|..|:|..:|||.|:...:.:||:.|||..||  
  Fly   690 ESRLEVAIKMLSDEHSNK----QEFLREASVMMRLEHKCIVRLIGIAKGEMLMMVQELAPLGSML 750

  Fly   211 --LLDTLRKQCRHTSLTIIWNWSVQIVTGMAYLEQKRFLHRDLACRNVLLAAGNKIKIGDFGLMR 273
              :||...:...:..|.:   |:.||..||.|||.:.|:|||||.||:||.|.::.||.|||:.|
  Fly   751 QYILDHGHEITANAELKV---WASQIACGMHYLESQHFVHRDLAARNILLTARHQAKISDFGMSR 812

  Fly   274 ALPQEDDCYVMSEHKKVPFPWCAPESLRFRQFSHASDTWMFGVTLWEMFSFGEDPWVGLNGSQIL 338
            :|......|..::..:.|..|.||||.....||||||.|.||||:|||||.|..|:..::....:
  Fly   813 SLRPGSTEYQFTQGGRWPIRWYAPESFNLGIFSHASDVWSFGVTIWEMFSLGAPPYGEISNVDAI 877

  Fly   339 RKIDREGERLHQPDACPPDVYAMMLQCWDKTPAERPTFAALKEYLA 384
            :.:| .||||.||:.||..:||:|..||.:.|.:||||..|.|:.|
  Fly   878 KLVD-SGERLPQPNLCPAYIYAVMQSCWKERPKDRPTFVYLTEFFA 922

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AckNP_647859.1 SAM_TNK-like 14..75 CDD:188938 7/68 (10%)
PTKc_Ack_like 128..385 CDD:270636 107/265 (40%)
UBA_TNK1 1031..1070 CDD:270513
SharkNP_524743.2 SH2_Nterm_shark_like 8..91 CDD:198210
Ank_2 <112..184 CDD:289560
ANK 117..241 CDD:238125
ANK repeat 124..151 CDD:293786
ANK repeat 153..184 CDD:293786
Ank_2 158..247 CDD:289560
ANK repeat 186..217 CDD:293786
ANK repeat 220..245 CDD:293786
Ank_4 224..274 CDD:290365
SH2_Cterm_shark_like 287..395 CDD:198211
TyrKc 662..921 CDD:197581 106/267 (40%)
PTKc_Syk_like 666..926 CDD:270650 107/266 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.