DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack and CG10702

DIOPT Version :9

Sequence 1:NP_647859.1 Gene:Ack / 38489 FlyBaseID:FBgn0028484 Length:1073 Species:Drosophila melanogaster
Sequence 2:NP_001188841.1 Gene:CG10702 / 35181 FlyBaseID:FBgn0032752 Length:946 Species:Drosophila melanogaster


Alignment Length:287 Identity:55/287 - (19%)
Similarity:92/287 - (32%) Gaps:88/287 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LREVQLEQFLDRIRDDLQVTRLAHFDYVLPDDLERCGLGKPAIRRL------MEAVRKKKAHQWR 80
            ||.:|..:.|:|:..|....|  |:.::|.|:.|...|..|: |:|      |...|..|....|
  Fly   371 LRSLQFLRNLERVHGDPLENR--HYSFILYDNKELSELWTPS-RQLEFMEGGMFMHRNNKLCNRR 432

  Fly    81 KNILSKLIGGGKQPSSKKQSSAARESSQGNGTQLTC------LIHEKDITMGLKLGDGSFGVVRR 139
            .......:          ....|.:|.|.|..::.|      |..:|.....:||          
  Fly   433 MREFQNAV----------THDRALDSLQTNDQEVQCSPLKLQLYVQKRTHRSVKL---------- 477

  Fly   140 GEWSASPAGKVI---------------------PVAVKV------LKSDNLTQPGI-----IDDF 172
             .|..|...:.|                     |:..::      |..|:|.:.|.     :||.
  Fly   478 -SWLKSQTSQKIELIHRPLLPGKLYHEESELDAPICTRINWKRRLLFPDDLIENGTHYLFDLDDL 541

  Fly   173 ------------FREVQAMHALDHANLVRLYGVVLSQPMMMITELAER-GSLLDTLRKQCRHTS- 223
                        |...:|..|.:..:.:......|..|...:.||.:: .|.|........|.| 
  Fly   542 QPDTRYVVLLRTFGNDEAHEAYEARSELTYVQTELDIPKPPLLELVKKTDSSLTVQMASHDHVSF 606

  Fly   224 -LTIIWNWSVQIVTGMAYLEQKRFLHR 249
             ||:.     ::.....|:||:.:.|:
  Fly   607 LLTVF-----ELSDDQDYIEQRNYCHQ 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AckNP_647859.1 SAM_TNK-like 14..75 CDD:188938 17/58 (29%)
PTKc_Ack_like 128..385 CDD:270636 29/169 (17%)
UBA_TNK1 1031..1070 CDD:270513
CG10702NP_001188841.1 Recep_L_domain 47..159 CDD:279382
Furin-like 171..297 CDD:279142
FU 210..258 CDD:238021
Recep_L_domain 328..441 CDD:279382 19/82 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.