DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack and Btk29A

DIOPT Version :9

Sequence 1:NP_647859.1 Gene:Ack / 38489 FlyBaseID:FBgn0028484 Length:1073 Species:Drosophila melanogaster
Sequence 2:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster


Alignment Length:274 Identity:108/274 - (39%)
Similarity:157/274 - (57%) Gaps:23/274 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 IHEKDITMGLKLGDGSFGVVRRGEWSASPAGKVIPVAVKVLKSDNLTQPGIIDDFFREVQAMHAL 182
            ||..::.:..:||.|.|||||||:|..|     |..|||::|...:::    |||..|.:.|..|
  Fly   521 IHPMELMLMEELGSGQFGVVRRGKWRGS-----IDTAVKMMKEGTMSE----DDFIEEAKVMTKL 576

  Fly   183 DHANLVRLYGVVLS-QPMMMITELAERGSLLDTLRKQCRHTSLTIIWNWS------VQIVTGMAY 240
            .|.|||:||||... :|:.::||..:.||||:.||   ||.. |:|.|..      :|:..||.|
  Fly   577 QHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLR---RHEK-TLIGNMGLLLDMCIQVSKGMTY 637

  Fly   241 LEQKRFLHRDLACRNVLLAAGNKIKIGDFGLMRALPQEDDCYVMSEHKKVPFPWCAPESLRFRQF 305
            ||:..::|||||.||.|:.:.|.:|:.||||.|.:  .||.|..|...|.|..|..||.|.:.:|
  Fly   638 LERHNYIHRDLAARNCLVGSENVVKVADFGLARYV--LDDQYTSSGGTKFPIKWAPPEVLNYTRF 700

  Fly   306 SHASDTWMFGVTLWEMFSFGEDPWVGLNGSQILRKIDREGERLHQPDACPPDVYAMMLQCWDKTP 370
            |..||.|.:||.:||:|:.|:.|:..|..::::.::.| |..|.:|.:|..::|.:|..||...|
  Fly   701 SSKSDVWAYGVLMWEIFTCGKMPYGRLKNTEVVERVQR-GIILEKPKSCAKEIYDVMKLCWSHGP 764

  Fly   371 AERPTFAALKEYLA 384
            .|||.|..|.:.||
  Fly   765 EERPAFRVLMDQLA 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AckNP_647859.1 SAM_TNK-like 14..75 CDD:188938
PTKc_Ack_like 128..385 CDD:270636 106/264 (40%)
UBA_TNK1 1031..1070 CDD:270513
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188
PTKc_Tec_like 521..778 CDD:173637 106/272 (39%)
Pkinase_Tyr 526..777 CDD:285015 104/266 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468345
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.