DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14995 and AT5G22320

DIOPT Version :10

Sequence 1:NP_728935.1 Gene:CG14995 / 38487 FlyBaseID:FBgn0035497 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_568416.1 Gene:AT5G22320 / 832292 AraportID:AT5G22320 Length:452 Species:Arabidopsis thaliana


Alignment Length:174 Identity:42/174 - (24%)
Similarity:66/174 - (37%) Gaps:50/174 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRLTEEMVIARAKQSDLSLIKKLNCWGSDLSDVSIIKRMRGVEVLALSVNKISTLSTFEDC--- 62
            |:.||.|.|:...|.:|...:|:||.....|:|||.:.:.:.:|.|.|..|.::.|...:.|   
plant     1 MNSLTVEQVLKEKKTNDPDSVKELNLGHKALTDVSCLSKFKNLEKLDLRFNNLTDLQGLKSCVNL 65

  Fly    63 -------------------TKLQELYLRKNSISDINEIAYLQN-------------------LPS 89
                               |||..|...||.:..:|||:.|.|                   |..
plant    66 KWLSVVENKLQSLNGIEALTKLTVLNAGKNKLKSMNEISSLVNLRALILNDNEISSICKLDLLKD 130

  Fly    90 LRNLWLEENPCCERAGPNYRSIVLRALPNLKKLDNVEVTQQEVE 133
            |.:|.|..||..|         :..:|..||.|..:.::...::
plant   131 LNSLVLSRNPISE---------IGDSLSKLKNLSKISLSDCRIK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14995NP_728935.1 leucine-rich repeat 21..42 CDD:275378 7/20 (35%)
leucine-rich repeat 43..64 CDD:275378 6/42 (14%)
PPP1R42 <44..131 CDD:455733 28/127 (22%)
leucine-rich repeat 65..89 CDD:275378 10/42 (24%)
leucine-rich repeat 90..118 CDD:275378 7/27 (26%)
dnaA 211..>389 CDD:455861
AT5G22320NP_568416.1 LRR 2..>243 CDD:443914 41/173 (24%)
leucine-rich repeat 21..42 CDD:275380 7/20 (35%)
leucine-rich repeat 43..64 CDD:275380 6/20 (30%)
leucine-rich repeat 65..86 CDD:275380 0/20 (0%)
leucine-rich repeat 87..108 CDD:275380 8/20 (40%)
leucine-rich repeat 109..130 CDD:275380 1/20 (5%)
leucine-rich repeat 131..153 CDD:275380 8/30 (27%)
leucine-rich repeat 154..176 CDD:275380 1/12 (8%)
leucine-rich repeat 177..199 CDD:275380
leucine-rich repeat 200..224 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.