Sequence 1: | NP_728935.1 | Gene: | CG14995 / 38487 | FlyBaseID: | FBgn0035497 | Length: | 454 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_083091.1 | Gene: | Cep97 / 74201 | MGIID: | 1921451 | Length: | 856 | Species: | Mus musculus |
Alignment Length: | 323 | Identity: | 66/323 - (20%) |
---|---|---|---|
Similarity: | 109/323 - (33%) | Gaps: | 118/323 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 SRLTEEMVIARAKQSDLSLIKKLNCWGSDLSDVSIIKRMRGVEVLALSVNKISTLSTFEDCTKLQ 66
Fly 67 E----------------------------------------------LYLRKNSISDINEIAYLQ 85
Fly 86 NLPSLRNLWLEENPCCERA----GPNYRSIVLRALPNLKKLDNVEVTQQEVEDA----------- 135
Fly 136 LRGG-------------------GVAAPEDEVYEDAYQQQQ----------QSRRSSPQQILQQQ 171
Fly 172 QHSYPQHSPPPQQQYQQQQQQQQQQQRGCTTPTKEPPQLPSPLVKNSSEGSISHSASDLYQVQ 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14995 | NP_728935.1 | leucine-rich repeat | 21..42 | CDD:275378 | 4/20 (20%) |
LRR_8 | 41..99 | CDD:290566 | 21/103 (20%) | ||
leucine-rich repeat | 43..64 | CDD:275378 | 6/20 (30%) | ||
LRR_4 | 44..82 | CDD:289563 | 16/83 (19%) | ||
LRR_RI | <56..>123 | CDD:238064 | 24/116 (21%) | ||
leucine-rich repeat | 65..89 | CDD:275378 | 12/69 (17%) | ||
leucine-rich repeat | 90..118 | CDD:275378 | 8/31 (26%) | ||
Cep97 | NP_083091.1 | leucine-rich repeat | 17..37 | CDD:275380 | |
LRR 1 | 37..58 | ||||
leucine-rich repeat | 38..59 | CDD:275380 | |||
LRR_4 | 58..99 | CDD:289563 | 8/35 (23%) | ||
LRR 2 | 59..80 | 4/16 (25%) | |||
leucine-rich repeat | 60..81 | CDD:275380 | 5/17 (29%) | ||
LRR_8 | 80..136 | CDD:290566 | 13/55 (24%) | ||
LRR_4 | 80..122 | CDD:289563 | 9/41 (22%) | ||
LRR 3 | 81..102 | 4/20 (20%) | |||
leucine-rich repeat | 82..103 | CDD:275380 | 4/20 (20%) | ||
LRR_4 | 103..144 | CDD:289563 | 9/40 (23%) | ||
LRR 4 | 103..124 | 5/20 (25%) | |||
leucine-rich repeat | 104..125 | CDD:275380 | 6/20 (30%) | ||
LRR 5 | 125..146 | 2/20 (10%) | |||
leucine-rich repeat | 126..147 | CDD:275380 | 2/20 (10%) | ||
LRR_8 | 147..206 | CDD:290566 | 12/58 (21%) | ||
LRR 6 | 147..168 | 0/20 (0%) | |||
leucine-rich repeat | 148..171 | CDD:275380 | 0/22 (0%) | ||
LRR 7 | 171..192 | 8/20 (40%) | |||
leucine-rich repeat | 172..196 | CDD:275380 | 10/23 (43%) | ||
LRR 8 | 196..205 | 2/8 (25%) | |||
CCP110-binding. /evidence=ECO:0000250 | 300..742 | 16/86 (19%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 430..451 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 498..525 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 646..672 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 737..840 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R8601 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |