DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14995 and Cep97

DIOPT Version :9

Sequence 1:NP_728935.1 Gene:CG14995 / 38487 FlyBaseID:FBgn0035497 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_083091.1 Gene:Cep97 / 74201 MGIID:1921451 Length:856 Species:Mus musculus


Alignment Length:323 Identity:66/323 - (20%)
Similarity:109/323 - (33%) Gaps:118/323 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SRLTEEMVIARAKQSDLSLIKKLNCWGSDLSDVSIIKRMRGVEVLALSVNKISTLSTFEDCTKLQ 66
            :||...|.:|:     |:.::.||...:.:..|..:|.:..:|.|.|:.|.:.|:.....||.||
Mouse    68 NRLVRMMGVAK-----LTQLRVLNLPHNSIGCVEGLKDLVHLEWLNLAGNNLKTMEQVNSCTALQ 127

  Fly    67 E----------------------------------------------LYLRKNSISDINEIAYLQ 85
            .                                              |.|.:|.|.|:|||::|.
Mouse   128 HLDLSDNNIPQIGDVSKLISLKTLLLHGNIITSLRMAPAYLPRNLSILSLAENEIRDLNEISFLA 192

  Fly    86 NLPSLRNLWLEENPCCERA----GPNYRSIVLRALPNLKKLDNVEVTQQEVEDA----------- 135
            :|..|..|.:..|||....    |.:||..::....||:.||...::|:|...|           
Mouse   193 SLSELEQLSIMNNPCVMATPSIPGFDYRPFIVSWCLNLRVLDGYVISQKESLKAEWLYSQGKGRS 257

  Fly   136 LRGG-------------------GVAAPEDEVYEDAYQQQQ----------QSRRSSPQQILQQQ 171
            .|.|                   |:...||...|....:|:          |....||...::.:
Mouse   258 YRPGQHIQLVQYLATVCPLTSALGLQTAEDAKLEKILSKQRFHQRQLMSQSQDEELSPLAAVETR 322

  Fly   172 QHSYPQHSPPPQQQYQQQQQQQQQQQRGCTTPTKEPPQLPSPLVKNSSEGSISHSASDLYQVQ 234
            .|..|:.| .|.|.:|:.:                      |:::.:|...||.:...||.|:
Mouse   323 VHRTPECS-SPGQDFQESE----------------------PVLQINSWVGISSNDDQLYAVK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14995NP_728935.1 leucine-rich repeat 21..42 CDD:275378 4/20 (20%)
LRR_8 41..99 CDD:290566 21/103 (20%)
leucine-rich repeat 43..64 CDD:275378 6/20 (30%)
LRR_4 44..82 CDD:289563 16/83 (19%)
LRR_RI <56..>123 CDD:238064 24/116 (21%)
leucine-rich repeat 65..89 CDD:275378 12/69 (17%)
leucine-rich repeat 90..118 CDD:275378 8/31 (26%)
Cep97NP_083091.1 leucine-rich repeat 17..37 CDD:275380
LRR 1 37..58
leucine-rich repeat 38..59 CDD:275380
LRR_4 58..99 CDD:289563 8/35 (23%)
LRR 2 59..80 4/16 (25%)
leucine-rich repeat 60..81 CDD:275380 5/17 (29%)
LRR_8 80..136 CDD:290566 13/55 (24%)
LRR_4 80..122 CDD:289563 9/41 (22%)
LRR 3 81..102 4/20 (20%)
leucine-rich repeat 82..103 CDD:275380 4/20 (20%)
LRR_4 103..144 CDD:289563 9/40 (23%)
LRR 4 103..124 5/20 (25%)
leucine-rich repeat 104..125 CDD:275380 6/20 (30%)
LRR 5 125..146 2/20 (10%)
leucine-rich repeat 126..147 CDD:275380 2/20 (10%)
LRR_8 147..206 CDD:290566 12/58 (21%)
LRR 6 147..168 0/20 (0%)
leucine-rich repeat 148..171 CDD:275380 0/22 (0%)
LRR 7 171..192 8/20 (40%)
leucine-rich repeat 172..196 CDD:275380 10/23 (43%)
LRR 8 196..205 2/8 (25%)
CCP110-binding. /evidence=ECO:0000250 300..742 16/86 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 430..451
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..525
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 646..672
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 737..840
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8601
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.