DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14995 and Lrrc6

DIOPT Version :9

Sequence 1:NP_728935.1 Gene:CG14995 / 38487 FlyBaseID:FBgn0035497 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_062330.1 Gene:Lrrc6 / 54562 MGIID:1859553 Length:473 Species:Mus musculus


Alignment Length:488 Identity:100/488 - (20%)
Similarity:174/488 - (35%) Gaps:134/488 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRLTEEMVIARAKQSD--------LSL-------IKKLNCWGSDL----------SDVSIIKRM 40
            |.|:||:::...|:.:|        |||       ::.::.|..||          ..:..:.::
Mouse     1 MGRITEDLIRRNAEHNDCVIFSLEELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIENVSKL 65

  Fly    41 RGVEVLALSVNKISTLSTFEDCTKLQELYLRKNSISDINEIAYLQNLPSLRNLWLEENPCCERAG 105
            :.:|.|.|::|.|..:...|.|..|.:|.|..|.|.:::.:..|.:...|:.|:|..|||.:..|
Mouse    66 KKLEYLNLALNNIERIENLEGCEWLTKLDLTVNFIGELSSVKTLTHNIHLKELFLMGNPCADFDG 130

  Fly   106 PNYRSIVLRALPNLKKLDNVEVTQQEVEDALRGGGVAAPEDEVYEDAYQQQQQSRRSSPQQILQQ 170
              ||..|:..|..||.||..|:.:.|...||:.......:....|.||..::...:...|:.|::
Mouse   131 --YRQFVVVTLQQLKWLDGKEIERSERIQALQNYTSVEQQIREQEKAYCLRRAKEKEEAQRKLEE 193

  Fly   171 QQHSYPQ---------------HSPPP----QQQYQQQQQQQQQQQRGCTTPTKEPPQL------ 210
            :..|..:               |:..|    .|.|.|..:.|::|..     |||...:      
Mouse   194 ENESEDKKKSSTGFDGHWYTDIHTACPSATENQDYPQVPETQEEQHN-----TKESDDIEDDLAF 253

  Fly   211 ---PSPLVKNSSEGSISHSASDLYQVQAAQPLKGSQPPTPTKEPVHPPSPMYNTITKEQRTSYHQ 272
               ||.....|...::.|...   |.:|...|      :..|:...||..:.....|....:..:
Mouse   254 WNKPSLFTPESRLETLRHMEK---QRKAQDKL------SEKKKKAKPPRTLITEDGKVLNVNEAK 309

  Fly   273 YDRSPGSDQESSP-----HTYR---------EVRPT---------PFPPSISAHSMKEYYQSDRP 314
            .|.|...|::.:.     ..||         :|:||         ||..::|.....:...:.|.
Mouse   310 LDFSLKDDEKHNQIILDLAVYRYMDTSLIEVDVQPTYVRVMVKGKPFQLALSTEVQPDRSSAKRS 374

  Fly   315 AYPAHY--------------RHSQTDL--TEWEEHQQV-------------PQVHHNPYGS---Q 347
            ....|.              :.:.|.:  |.....:|.             |..|..|..|   |
Mouse   375 QTTGHLLICMPKVGEMITGGQRTPTSVKTTSTSSREQTNPRKKQIERLEVDPSKHSCPDVSTIVQ 439

  Fly   348 KQLHQPQRRSAGPEMTPYRNGSARENGGEWDPE 380
            ::.|:|:|..:.|          |:...|.||:
Mouse   440 EKRHRPKRMESQP----------RDEPSEEDPD 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14995NP_728935.1 leucine-rich repeat 21..42 CDD:275378 3/30 (10%)
LRR_8 41..99 CDD:290566 16/57 (28%)
leucine-rich repeat 43..64 CDD:275378 7/20 (35%)
LRR_4 44..82 CDD:289563 12/37 (32%)
LRR_RI <56..>123 CDD:238064 21/66 (32%)
leucine-rich repeat 65..89 CDD:275378 6/23 (26%)
leucine-rich repeat 90..118 CDD:275378 11/27 (41%)
Lrrc6NP_062330.1 LRR_4 22..64 CDD:289563 6/41 (15%)
LRR 1 22..43 3/20 (15%)
leucine-rich repeat 23..45 CDD:275378 4/21 (19%)
LRR 2 45..66 2/20 (10%)
LRR_8 46..98 CDD:290566 11/51 (22%)
LRR_4 46..86 CDD:289563 6/39 (15%)
leucine-rich repeat 46..67 CDD:275378 1/20 (5%)
LRR 3 67..88 6/20 (30%)
leucine-rich repeat 68..89 CDD:275378 7/20 (35%)
LRR 4 89..110 5/20 (25%)
leucine-rich repeat 90..114 CDD:275378 6/23 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..244 12/60 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..292 4/27 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..473 16/86 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8601
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.