DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14995 and F33H2.3

DIOPT Version :10

Sequence 1:NP_728935.1 Gene:CG14995 / 38487 FlyBaseID:FBgn0035497 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001366886.1 Gene:F33H2.3 / 173372 WormBaseID:WBGene00009367 Length:229 Species:Caenorhabditis elegans


Alignment Length:164 Identity:41/164 - (25%)
Similarity:80/164 - (48%) Gaps:21/164 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTEEMVIARAKQSDLSLIKKLNCWGSDLSDVSIIKRMRGVEVLALSVNKISTLSTFEDCTK---- 64
            ||::::       :|.::..:.|   .|:.::....:..:..|.:|.|::...::|:...|    
 Worm    36 LTDQLI-------NLEMLSMVKC---GLTTLAGFPTLPALTYLDISDNQLGDNASFDVLVKNAPD 90

  Fly    65 LQELYLRKNSISDINEIAYLQNLPSLRNLWLEENPCCERAGPNYRSIVLRALPNLKKLDNVEVTQ 129
            |:::.|..|.:| ::.:..|:.||:|..|.|..||..... .:||..:...:|:||.||..:|..
 Worm    91 LKKITLASNKLS-LDNLRCLKVLPNLFELDLSNNPSLGLL-EDYREKMFEMIPSLKILDGCDVDG 153

  Fly   130 QEVEDALRG-GGVAAPEDEVYED----AYQQQQQ 158
            :|||:...| ||..:.|....||    :|.::.|
 Worm   154 EEVEEEFAGEGGEDSEEGSGDEDGPGLSYLEKSQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14995NP_728935.1 leucine-rich repeat 21..42 CDD:275378 2/20 (10%)
leucine-rich repeat 43..64 CDD:275378 4/20 (20%)
PPP1R42 <44..131 CDD:455733 25/90 (28%)
leucine-rich repeat 65..89 CDD:275378 6/23 (26%)
leucine-rich repeat 90..118 CDD:275378 7/27 (26%)
dnaA 211..>389 CDD:455861
F33H2.3NP_001366886.1 leucine-rich repeat 22..42 CDD:275380 2/12 (17%)
PPP1R42 <43..151 CDD:455733 27/112 (24%)
leucine-rich repeat 43..64 CDD:275380 3/23 (13%)
leucine-rich repeat 65..90 CDD:275380 5/24 (21%)
leucine-rich repeat 91..114 CDD:275380 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.