DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and gzmk

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_017208551.1 Gene:gzmk / 794999 ZFINID:ZDB-GENE-091204-352 Length:267 Species:Danio rerio


Alignment Length:254 Identity:57/254 - (22%)
Similarity:108/254 - (42%) Gaps:53/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 WVVALFSQGKYFGAGSLIAPEVVLTAA----------SIVVGKTDAEIVVRAGEWNTGQRSEFLP 128
            |:|::..:..:...|.||..:.|||:|          ::::|    .:.:..|....|..:..:|
Zfish    50 WMVSIQKEKIHICGGILIHKQWVLTSAQCKEVPVSSVTVLIG----SLSLSKGSQRIGILNYEIP 110

  Fly   129 SEDRPVARVVQHREFSYLLGANNIALLFL-----ANPFELKSHIRTICLPSQGRSFDQKRCLVTG 188
                        :.|:.....::|.|:.|     |.|:::..:.:.:  |      ...:|:|.|
Zfish   111 ------------KTFNEKTKEDDIMLIRLSKKVKAKPYKIPKNEKDV--P------PGTKCVVRG 155

  Fly   189 WGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGG-EKDAGDCLGDGG 252
            ||...:.||..|:..:.:|:.:::|.|| ::..|....::.|    ::|||. ::..|.|.||.|
Zfish   156 WGTTDYKDEQASDKLQMLEVLVVDRDQC-NRYYNRNPVITKD----MLCAGNTQQHRGTCWGDSG 215

  Fly   253 SALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNV-EMFRDWIYEHMAQNSNSVPF 310
            ..|.|       :....|:::...||.....|.|||.: :....||...:.|..||..|
Zfish   216 GPLEC-------KKNLVGVISGSQGCGIPKKPTVYTFLSKRHISWINSILRQQFNSTRF 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 53/242 (22%)
Tryp_SPc 67..297 CDD:214473 51/239 (21%)
gzmkXP_017208551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.