DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and TPSAB1

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:267 Identity:87/267 - (32%)
Similarity:130/267 - (48%) Gaps:45/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GLVANVKVPKDYSTPGQFPWVVALFSQGKY---FGAGSLIAPEVVLTAASIVVG---KTDAEIVV 113
            |:|...:.|:     .::||.|:|...|.|   |..||||.|:.|||||. .||   |..|.:.|
Human    30 GIVGGQEAPR-----SKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAH-CVGPDVKDLAALRV 88

  Fly   114 RAGEWNTGQRSEFLPSEDRPVARVVQHREF-SYLLGANNIALLFLANPFELKSHIRTICLPSQGR 177
            :..|.:...:.:.|     ||:|::.|.:| :..:|| :||||.|..|..:.||:.|:.||....
Human    89 QLREQHLYYQDQLL-----PVSRIIVHPQFYTAQIGA-DIALLELEEPVNVSSHVHTVTLPPASE 147

  Fly   178 SFDQ-KRCLVTGWGKVAFNDENYSN--IQKKIELPMINRAQCQ----------DQLRNTRLGVSF 229
            :|.. ..|.|||||.|. |||....  ..|::::|::....|.          |.:|..|     
Human   148 TFPPGMPCWVTGWGDVD-NDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVR----- 206

  Fly   230 DLPASLICAGGEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFR 294
               ..::|||..: ...|.||.|..|.|.:.   ..:.|||:|:||.||.:.|.|.:||.|..:.
Human   207 ---DDMLCAGNTR-RDSCQGDSGGPLVCKVN---GTWLQAGVVSWGEGCAQPNRPGIYTRVTYYL 264

  Fly   295 DWIYEHM 301
            |||:.::
Human   265 DWIHHYV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 84/252 (33%)
Tryp_SPc 67..297 CDD:214473 82/249 (33%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 85/261 (33%)
Tryp_SPc 31..267 CDD:214473 84/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.