DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and Prss32

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_081496.2 Gene:Prss32 / 69814 MGIID:1917064 Length:334 Species:Mus musculus


Alignment Length:307 Identity:88/307 - (28%)
Similarity:133/307 - (43%) Gaps:57/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PGIFNGMSF--TENLQP---------DPNQVCGMSNPNGLVANVKVPKDYSTPGQFPWVVALFSQ 81
            ||:..|...  |::..|         |.:.|||....:|.:    |....:..|::||.|::...
Mouse    14 PGVLLGSEVLPTDSDSPSTTTGRRSIDLDSVCGRPRTSGRI----VSGQDAQLGRWPWQVSVREN 74

  Fly    82 GKYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFL---------------PSED 131
            |.:...|||||.:.|||||..               :|.||.....               |.|.
Mouse    75 GAHVCGGSLIAEDWVLTAAHC---------------FNQGQSLSIYTVLLGTISSYPEDNEPKEL 124

  Fly   132 RPVARVVQHREFSY-LLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQ-KRCLVTGWGKVAF 194
            |.||:.::|..:|. ...:.:|||:.||:|.....::..:|||..|...|. ..|.|||||.:..
Mouse   125 RAVAQFIKHPSYSADEHSSGDIALVQLASPISFNDYMLPVCLPKPGDPLDPGTMCWVTGWGHIGT 189

  Fly   195 NDENYSNIQ-KKIELPMINRAQCQDQLR-NTRLGVSFDLPASLICAG---GEKDAGDCLGDGGSA 254
            |........ :::::|:|:...|....: |:..|....:...::|||   |:|||  |.||.|..
Mouse   190 NQPLPPPFTLQELQVPLIDAETCNTYYQENSIPGTEPVILEGMLCAGFQEGKKDA--CNGDSGGP 252

  Fly   255 LFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHM 301
            |.|.:.   ..:.|||:|:||..|.....|.|||||.::..||...|
Mouse   253 LVCDIN---DVWIQAGVVSWGSDCALFKRPGVYTNVSVYISWIQNTM 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 76/254 (30%)
Tryp_SPc 67..297 CDD:214473 74/251 (29%)
Prss32NP_081496.2 Tryp_SPc 53..292 CDD:214473 75/262 (29%)
Tryp_SPc 54..295 CDD:238113 77/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.