DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and zgc:123295

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:271 Identity:77/271 - (28%)
Similarity:129/271 - (47%) Gaps:52/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VCGMSNPNGLVANVKVPKDYSTPGQFPWVVALFS--QGKYFGAGSLIAPEVVLTAA-----SIVV 104
            |||.:..|..:    |....:..|.:||.|:|.|  .|.:|..||||..:.||:||     ||  
Zfish    26 VCGRAPLNTKI----VGGQNAGAGSWPWQVSLQSPTYGGHFCGGSLINKDWVLSAAHCFQDSI-- 84

  Fly   105 GKTDAEIVVRAGEWNTGQRSEFLPSED--------RPVARVVQHREFSYLLGANNIALLFLANPF 161
                ..|:|:.|          |.|:.        :.|.:|:.|..::.....|:|||:.|.:..
Zfish    85 ----GTIMVKLG----------LQSQSGSNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSV 135

  Fly   162 ELKSHIRTICLPSQGRSFDQ-KRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRL 225
            ....:|..:||.:.|.::.. ....||||||::.......:|.:::|:|:::.:.|       :.
Zfish   136 TFNDYIEPVCLAAAGNTYAAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDC-------KR 193

  Fly   226 GVSFDLPASLICAG----GEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAV 286
            ....::.:::||||    |.||:  |.||.|..:   :..:.|::.|:|||::|.||.|...|.|
Zfish   194 AYPGEITSNMICAGLLDQGGKDS--CQGDSGGPM---VSRNGSQWIQSGIVSFGRGCAEPGYPGV 253

  Fly   287 YTNVEMFRDWI 297
            |..|..::|||
Zfish   254 YARVSQYQDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 72/251 (29%)
Tryp_SPc 67..297 CDD:214473 70/249 (28%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 71/260 (27%)
Tryp_SPc 36..264 CDD:238113 71/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.