DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and zgc:123217

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:305 Identity:77/305 - (25%)
Similarity:127/305 - (41%) Gaps:55/305 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLVSFLCSATGQNEGGAPGIFNGMSFTENLQPDPNQVCGMSNPN-GLVANVKVPKDYSTPGQFPW 74
            |||..|.||.            .|..|::........||::..| .:|.....|     .|.:||
Zfish     3 LLVLLLSSAV------------IMLSTQDSNAQTTYECGVAPLNTRIVGGTDAP-----AGSWPW 50

  Fly    75 VVALFSQGKYFGAGSLIAPEVVLTAASIVVG------------KTDAEIVVRAGEWNTGQRSEFL 127
            .|::....::...|:||..:.|:|||..::.            :|.:..|....|...|.:|   
Zfish    51 QVSIHYNNRHICGGTLIHSQWVMTAAHCIINTNINVWTLYLGRQTQSTSVANPNEVKVGIQS--- 112

  Fly   128 PSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSF-DQKRCLVTGWGK 191
                     ::.|..|:..|..|:|:|:.|:.|.....:||.|||.:....| :...|..||||.
Zfish   113 ---------IIDHPSFNNSLLNNDISLMKLSQPVNFSLYIRPICLAANNSIFYNGTSCWATGWGN 168

  Fly   192 VAFNDENYSNIQ--KKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGDGGSA 254
            :. .|:.....|  :::::|::..:.|..:..:..   :..:...:||| |:.:.|.|.||.|..
Zfish   169 IG-KDQALPAPQTLQQVQIPVVANSLCSTEYESVN---NATITPQMICA-GKANKGTCQGDSGGP 228

  Fly   255 LFCPMEADPSRYEQAGIVNWG--IGCQEENVPAVYTNVEMFRDWI 297
            ..|   ...|.:.||||.::|  .||.....|.||:.|..|:.||
Zfish   229 FQC---KQGSVWIQAGITSYGTSAGCAVGAYPDVYSRVSEFQSWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 64/248 (26%)
Tryp_SPc 67..297 CDD:214473 62/246 (25%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 64/258 (25%)
Tryp_SPc 37..273 CDD:238113 66/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.