DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG34458

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:285 Identity:71/285 - (24%)
Similarity:129/285 - (45%) Gaps:57/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 MSNPNGLV-------------ANVKVPKD-------YSTPGQFPWVVALFSQGKYFGAGSLIAPE 94
            ||:.|.||             :::.|.::       ::.|||||..|:|...|::...||||:..
  Fly     1 MSSVNNLVKLSILLLAVTFVHSDMDVAEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDT 65

  Fly    95 VVLTAASIVVGKTDAEI--VVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFL 157
            :::|||...:|:...::  :|...:.:.|....|      .:|:.:.|..::......:::|:.|
  Fly    66 MIVTAAHCTMGQNPGQMKAIVGTNDLSAGNGQTF------NIAQFIIHPRYNPQSQDFDMSLIKL 124

  Fly   158 ANPFELKSHIRTICLPSQGRSF-DQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQ-CQDQL 220
            ::|..:...::||.|.....:: .....:::|:|.          |.:.::||  ||.: .|.||
  Fly   125 SSPVPMGGAVQTIQLADSDSNYAADTMAMISGFGA----------INQNLQLP--NRLKFAQVQL 177

  Fly   221 RNTRLGVSFDLPA---SLICAGGEK-DAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEE 281
            .:.....|.::|.   .::|||... ....|.||.|.    |:..|...:   |:|:||.||..:
  Fly   178 WSRDYCNSQNIPGLTDRMVCAGHPSGQVSSCQGDSGG----PLTVDGKLF---GVVSWGFGCGAK 235

  Fly   282 NVPAVYTNVEMFRDWIYEHMAQNSN 306
            ..||:||.|...|.||    .||:|
  Fly   236 GRPAMYTYVGALRSWI----KQNAN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 62/240 (26%)
Tryp_SPc 67..297 CDD:214473 60/237 (25%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 60/244 (25%)
Tryp_SPc 32..254 CDD:238113 62/250 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.