DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and zgc:112038

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:269 Identity:80/269 - (29%)
Similarity:132/269 - (49%) Gaps:35/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VCG---MSNPNGLVANVKVPKDYSTPGQFPWVVAL--FSQGKYFGAGSLIAPEVVLTAASIVVGK 106
            |||   ::|.||        .|.:..|.:||..::  .|...:...||||..:.||:||...:..
Zfish    26 VCGQAPLNNNNG--------GDDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHCFMIT 82

  Fly   107 TDAEIVVRAG-EWNTGQRSEFLPSE-DRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRT 169
            ..|.|.:..| ::.||..    |:| .|.:.::|.|.::|.....|:||||.|::......:||.
Zfish    83 ATANIKIFLGRQFQTGSN----PNEISRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTFTDYIRP 143

  Fly   170 ICLPSQGRSF-DQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPA 233
            :||.|....| ...:..:|||.|...:|...:|:.::::||:::..:|....:    |:..|   
Zfish   144 VCLASADSVFAGGTKSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNADYK----GIITD--- 201

  Fly   234 SLICAG---GEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRD 295
            ::||||   |.|||  |.||.|..:   :..:.||:.|:|||::|..|.....|.:||.|..::.
Zfish   202 NMICAGINEGGKDA--CQGDSGGPM---VSQNGSRWIQSGIVSFGRECGLPRYPGIYTRVSQYQS 261

  Fly   296 WIYEHMAQN 304
            ||...:..|
Zfish   262 WITSELRTN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 72/240 (30%)
Tryp_SPc 67..297 CDD:214473 70/237 (30%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 72/249 (29%)
Tryp_SPc 37..263 CDD:238113 72/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.