DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and Tpsab1

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:263 Identity:81/263 - (30%)
Similarity:128/263 - (48%) Gaps:28/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NVKVPKDYSTPGQ------FPWVVALFSQGKY---FGAGSLIAPEVVLTAASIVVGKTDAEIVVR 114
            ::.:|::....||      :||.|:|.....|   |..||||.|:.|||||. .||...|:    
  Rat    58 SLAMPREGIVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQWVLTAAH-CVGPNKAD---- 117

  Fly   115 AGEWNTGQRSEFLPSEDR--PVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGR 177
            ..:.....|.::|...|.  .|::::.|.:|.......:||||.|.||..:.|::.|:.||....
  Rat   118 PNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSLPPASE 182

  Fly   178 SFDQ-KRCLVTGWGKVAFNDENYSN--IQKKIELPMINRAQCQDQLR---NTRLGVSFDLPASLI 236
            :|.. ..|.|||||.:. ||.:...  ..:::::|::....|..:..   ||...|.. :...::
  Rat   183 TFPSGTLCWVTGWGNIN-NDVSLPPPFPLEEVQVPIVENRLCDLKYHKGLNTGDNVHI-VRDDML 245

  Fly   237 CAGGEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHM 301
            |||.| ....|.||.|..|.|.:|   ..:.|||:|:||.||.:.|.|.:||.|..:.||||.::
  Rat   246 CAGNE-GHDSCQGDSGGPLVCKVE---DTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIYRYV 306

  Fly   302 AQN 304
            .::
  Rat   307 PKD 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 80/249 (32%)
Tryp_SPc 67..297 CDD:214473 77/246 (31%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 77/246 (31%)
Tryp_SPc 66..302 CDD:238113 77/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346375
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.