DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and prss60.2

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:274 Identity:90/274 - (32%)
Similarity:136/274 - (49%) Gaps:42/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VCGMSNPNG-LVANVKVPKDYSTPGQFPWVVALFS--QGKYFGAGSLIAPEVVLTAASIVVGKTD 108
            |||.:..|. :|..|..|:     |.:||.|:|.|  .|.:|..||||:.|.|||||..:.|.::
Zfish    24 VCGQAPLNSRIVGGVNAPE-----GSWPWQVSLQSPRYGGHFCGGSLISSEWVLTAAHCLPGVSE 83

  Fly   109 AEIVVRAGE-----WNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIR 168
            :.:||..|.     .||.:.|       |.||:::.|..::.....|:||||.|::......:||
Zfish    84 SSLVVYLGRRTQQGVNTHETS-------RNVAKIIVHSSYNSNTNDNDIALLRLSSAVTFNDYIR 141

  Fly   169 TICLPSQGRSFDQ-KRCLVTGWGKV-AFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDL 231
            .:||.:|...:.. ....:||||.| |..:.....|.::..:|::...:|     |.:|| |..:
Zfish   142 PVCLAAQNSVYSAGTSSWITGWGDVQAGVNLPAPGILQETMIPVVANDRC-----NAQLG-SGTV 200

  Fly   232 PASLICAG---GEKDAGDCLGDGGSAL---FCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNV 290
            ..::||||   |.||.  |.||.|..:   .|.:      :.||||.:||.||.:.|.|.|||.|
Zfish   201 TNNMICAGLAKGGKDT--CQGDSGGPMVTRLCTV------WIQAGITSWGYGCADPNSPGVYTRV 257

  Fly   291 EMFRDWIYEHMAQN 304
            ..::.||...::||
Zfish   258 SQYQSWISSKISQN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 81/247 (33%)
Tryp_SPc 67..297 CDD:214473 79/244 (32%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 82/256 (32%)
Tryp_SPc 34..267 CDD:238113 84/258 (33%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587613
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.