DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and Prss44

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:318 Identity:92/318 - (28%)
Similarity:141/318 - (44%) Gaps:57/318 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TGQNE-------GGAPGIFNGMSFT------------ENLQP--DPNQVCGMSNP---NGLVANV 60
            ||..|       ||:...|:.|.||            ::..|  .|...||....   .|..|.:
  Rat    57 TGMPETSLPLKPGGSMTPFDSMGFTPGHSFSSMSLSRQSFPPWIPPTSACGHRTARIVGGKPAPI 121

  Fly    61 KVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGE---WNTGQ 122
            :         ::||.|:|....::...||||:...|:|||..|.|..|  .||..||   |::  
  Rat   122 R---------KWPWQVSLQVHKQHICGGSLISKWWVMTAAHCVYGHLD--YVVSMGEADLWSS-- 173

  Fly   123 RSEFLPSEDRPVARVVQHREFSYLLG-ANNIALLFLANPFELKSHIRTICLPSQGRSF---DQKR 183
                 .|...||..::.|:::|.:.. .::|||:.||.|.....:|:.:|:|.  :||   ....
  Rat   174 -----MSVKIPVQDIIVHQDYSVMRTIVHDIALVLLAFPVNYSVNIQPVCIPE--KSFLVQPGTL 231

  Fly   184 CLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGD-C 247
            |.||||||......: |.:.::::|.:|...:|...|::. .|..|.|.......|..|..|| |
  Rat   232 CWVTGWGKTIERGRS-SRVLREVDLSIIRHERCNQILKDI-TGRIFTLVQEGGVCGYNKKGGDAC 294

  Fly   248 LGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHMAQNS 305
            .||.|..:.|...   ..:.|.|||:||:||.....|.:||.|..:||||.:.:::.|
  Rat   295 QGDSGGPMVCEFN---KTWVQVGIVSWGLGCGRIGYPGIYTEVSYYRDWIIKELSRAS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 76/240 (32%)
Tryp_SPc 67..297 CDD:214473 74/237 (31%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 76/253 (30%)
Tryp_SPc 113..341 CDD:238113 76/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.