DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG11313

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:293 Identity:86/293 - (29%)
Similarity:123/293 - (41%) Gaps:55/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LQPDPNQVCGMSNPNGLVANVKVPKDYSTP-GQFPWVVAL------FSQGKYFGAGSLIAPEVVL 97
            |.|| ..:||     |.:|..::.|...|. .:|.|:|.|      ..|.:.:.|||||....|:
  Fly   100 LLPD-RSICG-----GDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVV 158

  Fly    98 TAASIVVGKTDA-------EIVVRAGEWNTGQ-----RSEFLPSEDRPVARVVQ----HREFSYL 146
            |||..|...|.|       .:.||.||.||..     ....||   .||...|:    |..|...
  Fly   159 TAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLP---EPVQIAVEEIRIHESFGTR 220

  Fly   147 LGANNIALLFLANPFELKSHIRTICLPS--------QGRSFDQKRCLVTGWGKVAFNDENYSNIQ 203
            |..|:|||:.||........||.:||||        .|::|     .|.|||:...::.  |.::
  Fly   221 LFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAF-----TVAGWGRTLTSES--SPVK 278

  Fly   204 KKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGDGGSALFCPMEADPSRYEQ 268
            .|:.:..:....|:.:..:..:     |..|.:||.|......|.||.|..|   |......:..
  Fly   279 MKLRVTYVEPGLCRRKYASIVV-----LGDSHLCAEGRSRGDSCDGDSGGPL---MAFHEGVWVL 335

  Fly   269 AGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHM 301
            .|||::|:.|.....|||||||..:..||.:::
  Fly   336 GGIVSFGLNCGSRFWPAVYTNVLSYETWITQNI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 78/263 (30%)
Tryp_SPc 67..297 CDD:214473 76/260 (29%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 79/268 (29%)
Tryp_SPc 116..364 CDD:214473 77/265 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457337
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.