DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG11836

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:317 Identity:87/317 - (27%)
Similarity:139/317 - (43%) Gaps:64/317 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TGQNEGGAPGIFN-------------GMSFTE------------NLQPDPNQVCGMSN------- 52
            ||.|:..:..:|:             |:|.||            |...|    ||.||       
  Fly    39 TGHNKRTSKFLFDTIFRISSGVSNAFGLSDTEDEVEYTENSSLKNCDCD----CGFSNEEIRIVG 99

  Fly    53 --PNGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRA 115
              |.|:             .|:||:..:...||:...|||:..:.||:||..|.....::|.|..
  Fly   100 GKPTGV-------------NQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIF 151

  Fly   116 GEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFD 180
            |:.:....|| ..:..|.|..|::|:.|......|:||||.|..|......|:.||||.......
  Fly   152 GDHDQEITSE-SQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPA 215

  Fly   181 QKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQ-LRNTRLGVSFDLPASLICAGGEKDA 244
            .:...|.|||:.:...| ..:|..::::|:::..:|::| .::||      :.:|::|| |....
  Fly   216 GRIGTVVGWGRTSEGGE-LPSIVNQVKVPIMSITECRNQRYKSTR------ITSSMLCA-GRPSM 272

  Fly   245 GDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHM 301
            ..|.||.|..|   :.::..:|...|||:||:||..|..|.||:.|..|..||..::
  Fly   273 DSCQGDSGGPL---LLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 71/233 (30%)
Tryp_SPc 67..297 CDD:214473 69/230 (30%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 73/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457671
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.