DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG7142

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:250 Identity:69/250 - (27%)
Similarity:114/250 - (45%) Gaps:25/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KDYSTPGQFPWVVALF----SQG-KYFGAGSLIAPEVVLTAASIVVGKTDAE-IVVRAGEWNT-G 121
            |..:||...|:||::.    .|| .::.||::|....:||||..:......| .|:.||..:. .
  Fly    83 KREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHD 147

  Fly   122 QRSEFLPSEDRPVARVVQHREFSYLLGAN--NIALLFLANPFELKSHIRTICLPSQGRSFDQKRC 184
            |:.|....:.|.:...|:|.  .||.|.|  :|||::...|....::::...||.|....:....
  Fly   148 QKGEASNIQMRHIDYYVRHE--LYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGT 210

  Fly   185 LVTGWGKVAFND-ENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGG-EKDAGDC 247
            |. |||.|:... .||.:..::..:|:::...|:..|..:.|    .|..:.:|.|. ......|
  Fly   211 LY-GWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGL----PLHETNLCTGPLTGGVSIC 270

  Fly   248 LGDGGSALFCPMEADPSRYEQA----GIVNWG-IGCQEENVPAVYTNVEMFRDWI 297
            ..|.|..|.  .:.....:|||    |||:|| :.|.::|.|:|:..|..|.:||
  Fly   271 TADSGGPLI--QQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 67/246 (27%)
Tryp_SPc 67..297 CDD:214473 66/245 (27%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 67/248 (27%)
Tryp_SPc 84..323 CDD:214473 66/247 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.