DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and ea

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:294 Identity:93/294 - (31%)
Similarity:131/294 - (44%) Gaps:50/294 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TENLQPDPNQVCGMSNPNGLVANVKVPKDYSTPGQFPWVVAL---FSQGK--YFGAGSLIAPEVV 96
            :.:|.|.|.| ||....|.:...:|...|     :|||:..:   .||||  :...||||:...|
  Fly   110 SNSLLPLPGQ-CGNILSNRIYGGMKTKID-----EFPWMALIEYTKSQGKKGHHCGGSLISTRYV 168

  Fly    97 LTAASIVVGK---TDAEIV-VRAGEWNT-----------GQRSEFLPSEDRPVARVVQHREFSYL 146
            :||:..|.||   ||..:. ||.|||:|           |.:....|..|.||.|.:.|.:  |:
  Fly   169 ITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPD--YI 231

  Fly   147 LGA----NNIALLFLANPFELKSHIRTICLP----SQGRSFDQKRCLVTGWGKVAFNDENYSNIQ 203
            ..:    |:||||.||...|....:|.||||    .:..:||.....|.||||.  ...:.||::
  Fly   232 PASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKT--EQLSASNLK 294

  Fly   204 KKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGDGGSALFCPMEADPSR--- 265
            .|..:......:||    |........|..:.:||||::....|.||.|..|   :..|.::   
  Fly   295 LKAAVEGFRMDECQ----NVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPL---IGLDTNKVNT 352

  Fly   266 -YEQAGIVNWG-IGCQEENVPAVYTNVEMFRDWI 297
             |..||:|::| ..|.....|.|||.|..:.|||
  Fly   353 YYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 84/264 (32%)
Tryp_SPc 67..297 CDD:214473 82/262 (31%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 84/274 (31%)
Tryp_SPc 128..389 CDD:238113 86/275 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.