DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG3916

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:290 Identity:75/290 - (25%)
Similarity:115/290 - (39%) Gaps:68/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SFTENLQPDPNQVCGMSNPNGLVANVKVPKDYSTPGQFPWVVALFSQGK----YFGAGSLIAPEV 95
            |.||:    |.::.|....|..|               |:.|:|..|.:    :|..||:::.:.
  Fly    23 STTES----PTRINGGQRVNETV---------------PFQVSLQMQRRGRWQHFCGGSIVSGQH 68

  Fly    96 VLTAASIV--VGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLG---ANNIALL 155
            |||||..:  :...|..:||....|..|.....|         |.:|....|.:.   .|:|||:
  Fly    69 VLTAAHCMEKMKVEDVSVVVGTLNWKAGGLRHRL---------VTKHVHPQYSMNPRIINDIALV 124

  Fly   156 FLANPFEL-KSHIRTICLPSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQ 219
            .:..||.| :|.|.||.:....|..::....:||||..:               |..:.|...||
  Fly   125 KVTPPFRLERSDISTILIGGSDRIGEKVPVRLTGWGSTS---------------PSTSSATLPDQ 174

  Fly   220 LR--NTRLGVS--------FDLPASLICAGGEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNW 274
            |:  |.|. :|        |.:..:.|||...:..|.|:||.|..|..|    ..:....|||::
  Fly   175 LQALNYRT-ISNEDCNQKGFRVTRNEICALAVQGQGACVGDSGGPLIRP----GKQPHLVGIVSY 234

  Fly   275 GIGCQEENVPAVYTNVEMFRDWIYEHMAQN 304
            |.....:..|.|||.|..|..:|.:.:.|:
  Fly   235 GSSTCAQGRPDVYTRVSSFLPYISQVINQD 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 67/252 (27%)
Tryp_SPc 67..297 CDD:214473 66/249 (27%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 69/270 (26%)
Tryp_SPc 31..260 CDD:238113 70/272 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.