DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG17404

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:263 Identity:81/263 - (30%)
Similarity:123/263 - (46%) Gaps:43/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PNGLVANVKVPKDYSTPGQ-FPWVVALFSQGK----YFGAGSLIAPEVVLTAASIVVGKTDAEIV 112
            |:.:|....:|     ||: .|:.|:|..:.:    :|..||:|||..:||||....|...:.:.
  Fly    32 PHRIVGGADIP-----PGEHVPYQVSLQYRTRGGQMHFCGGSIIAPNRILTAAHCCQGLNASRMS 91

  Fly   113 VRAGEW---NTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFEL-KSHIRTICLP 173
            |.||..   ..|.||:.|.....|     :::|    |..:::|:|.:..|.:| .|.|..|...
  Fly    92 VVAGIRGLNEKGSRSQVLSYSIHP-----KYQE----LVTSDLAVLSIKPPLKLNNSTISAIEYR 147

  Fly   174 SQGRSF--DQKRCLVTGWG---KVAF---NDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFD 230
            |||:.|  ......:||||   .|.|   ::.||.|:.:::....|:.::|    ||..:....|
  Fly   148 SQGKDFVGGGVPVTLTGWGLRLPVPFPFLDNVNYPNVLQRMSYHTISNSEC----RNAGMESVTD 208

  Fly   231 LPASLICAGGEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWG-IGCQEENVPAVYTNVEMFR 294
               :.|||.| ...|.|.||.|..|.  ||: .:..:|.|||::| :.|.....|.|||.|..|.
  Fly   209 ---TEICARG-PFRGACSGDSGGPLV--MES-KNGLQQVGIVSYGLVVCGLYISPDVYTRVSTFS 266

  Fly   295 DWI 297
            |||
  Fly   267 DWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 78/249 (31%)
Tryp_SPc 67..297 CDD:214473 76/247 (31%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 78/259 (30%)
Tryp_SPc 35..269 CDD:238113 78/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.