DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and Sp7

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:309 Identity:87/309 - (28%)
Similarity:134/309 - (43%) Gaps:54/309 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SATGQNEGGAPGIFNGMSFTENLQPDPNQVCGMSNPNGLVANVKVPKDYSTPGQFPWVVALFSQG 82
            |::.:.:.|..|:       .||.|.|.: ||   |:.....|....| :...:|.|:..|    
  Fly   106 SSSSRGQDGQAGL-------GNLLPSPPK-CG---PHSFSNKVYNGND-TAIDEFNWMALL---- 154

  Fly    83 KYFG---------AGSLIAPEVVLTAASIVVGKTDAEI----VVRAGEWNTGQRSEFL------P 128
            :|..         .||||....|||||..|:|..:.|:    .||.||::|.:..:.:      |
  Fly   155 EYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRLGEYDTSKDVDCIDDICNQP 219

  Fly   129 SEDRPVARVVQHREFSYLLGAN-----NIALLFLANPFELKSHIRTICLP--SQGRSFDQKRCL- 185
            .....:.:...|.::.   .||     :||||.|..|..|..:|:.:|||  |...:.:....| 
  Fly   220 ILQLGIEQATVHPQYD---PANKNRIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLV 281

  Fly   186 VTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGD 250
            |:|||:.  .....|.|:::::||:.:...|..:.. ||   :..|.:|.:|.|||.....|.||
  Fly   282 VSGWGRT--TTARKSTIKQRLDLPVNDHDYCARKFA-TR---NIHLISSQLCVGGEFYRDSCDGD 340

  Fly   251 GGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYE 299
            .|..|.  .......:.|.|:|::|..|..|..|.|||.|..:.|||.|
  Fly   341 SGGPLM--RRGFDQAWYQEGVVSFGNRCGLEGWPGVYTRVADYMDWIVE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 75/260 (29%)
Tryp_SPc 67..297 CDD:214473 72/256 (28%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 74/264 (28%)
Tryp_SPc 137..388 CDD:238113 77/267 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457325
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.