DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and Prss46

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_006244055.1 Gene:Prss46 / 408245 RGDID:1302970 Length:314 Species:Rattus norvegicus


Alignment Length:284 Identity:80/284 - (28%)
Similarity:122/284 - (42%) Gaps:40/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CGMSNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVV-GKTDAEI 111
            ||.:|.:..|.|.||.:    .|::||.|::...|.|..:||||....|||||..:. .|..|..
  Rat    35 CGQTNISCKVVNGKVVE----VGKWPWQVSILFLGMYICSGSLIHHHWVLTAAHCLQRSKNPANY 95

  Fly   112 VVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICL---- 172
            .|:.|.......|    |.:..|..:|.|..|...: :::||:|.|..|......|:.|||    
  Rat    96 TVKVGVQTLPDNS----SSELLVTSIVIHENFINHM-SHDIAILKLKYPVTWSPFIQPICLPEVN 155

  Fly   173 --PSQGRSFDQKRCLVTGWG--KVAFNDENYSNIQKKIELPMINRAQCQDQ-----LRNTRLGVS 228
              ||.|     ..|.|.|||  |.....:...::| .:.:.::|...|..:     |:|.:..:.
  Rat   156 FKPSIG-----TMCWVIGWGLEKAKGAPKTPYSVQ-GVAVRIVNNEICNHRYQFLLLKNQKKFIG 214

  Fly   229 FDLPASLICAGGEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMF 293
            .|    ::|...|.....|....||:|.|.|.   ..:.|.|:|:|..||.....|::||:...|
  Rat   215 ND----MLCTSPEWGLDTCQDASGSSLVCQMN---KTWIQMGVVSWNFGCGRRQFPSIYTSTSHF 272

  Fly   294 RDWIYEHMAQNSNSVPFAAGQLPS 317
            ..||...:    ..:.||:..:||
  Rat   273 TQWIKRQI----GDLKFASMAVPS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 69/246 (28%)
Tryp_SPc 67..297 CDD:214473 67/243 (28%)
Prss46XP_006244055.1 Tryp_SPc 43..276 CDD:214473 71/254 (28%)
Tryp_SPc 44..279 CDD:238113 73/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.