DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and Prss45

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001008864.1 Gene:Prss45 / 408244 RGDID:1303021 Length:330 Species:Rattus norvegicus


Alignment Length:256 Identity:67/256 - (26%)
Similarity:117/256 - (45%) Gaps:40/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 FPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPSEDR---- 132
            :||.|:|..:.::...|:||....|::||..:.|  :.|.:|..|.      |...||...    
  Rat    61 WPWEVSLQIENEHVCGGALIDQSWVVSAAHCIQG--NKEYLVMLGS------STLQPSGSPWALK 117

  Fly   133 -PVARVVQHREFSYLLGAN----NIALLFLANPFELKSHIRTICLPSQGRSFDQK---RCLVTGW 189
             ||..::.|.::   .|.|    :||||.|..|.....:|:.||||.  .:|:.|   :|.||||
  Rat   118 IPVGDIIMHPKY---WGQNFIRSDIALLCLETPVTFNKYIQPICLPE--HNFNLKVGMKCWVTGW 177

  Fly   190 GKVAFNDENYSNIQKKIEL-----PMINRAQCQDQLRNTRLGVSFDLP---ASLICAGGEKDAGD 246
            |:.  .....:.:.:.:||     .:::...| |::.:.:......:|   .::||....:: ..
  Rat   178 GQA--KQHPSAKLTRSLELWEAEVSIVDNKNC-DRVFHKKTFYPQVIPLIRKNMICTTNHRE-NP 238

  Fly   247 CLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHMAQNSNS 307
            |.||.|..|.|.:.   .|:..|||.:|...|.:....:|||.::.:..||.|.:::.:.|
  Rat   239 CYGDPGGPLACEVH---GRWILAGIFSWEKACTKAPNLSVYTRIDKYTGWIKEQVSRGARS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 65/247 (26%)
Tryp_SPc 67..297 CDD:214473 63/244 (26%)
Prss45NP_001008864.1 Tryp_SPc 57..289 CDD:238113 65/247 (26%)
Tryp_SPc 57..286 CDD:214473 63/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.