DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG6865

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:286 Identity:74/286 - (25%)
Similarity:118/286 - (41%) Gaps:66/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NQVCGMSNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKTDA 109
            ||.|.:.||. :|...:..::     :.|::|:|..:|.:|..|::|:...:|||...:.     
  Fly    25 NQPCSVRNPK-IVGGSEAERN-----EMPYMVSLMRRGGHFCGGTIISERWILTAGHCIC----- 78

  Fly   110 EIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANN----------------------- 151
                      .|.:....|::.:.|..:...||  ||.|..|                       
  Fly    79 ----------NGLQQFMKPAQIQGVVGLHSIRE--YLNGIGNGPDALRVDFKNIVPHPQYDCNDV 131

  Fly   152 ---IALLFLANPFELKSHIRTICLPSQ--GRSFDQKRCLVTGWG----KVAFNDENYSNIQKKIE 207
               ||||.|..|....|||:..|:.|:  .||.:|:...|:|||    ..|.||.  |::.:|..
  Fly   132 KHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDR--SDVLRKAT 194

  Fly   208 LPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGD-CLGDGGSALFCPMEADPSRYEQAGI 271
            :.:.|...|:...|:  ||.|..:..:.:|||.|....| |..|.|..|.      ...:...|:
  Fly   195 VKIWNNEACERSYRS--LGKSNTIGETQLCAGYENGQIDSCWADSGGPLM------SKEHHLVGV 251

  Fly   272 VNWGIGCQEENVPAVYTNVEMFRDWI 297
            |:.||||....:|.:||.|..:..|:
  Fly   252 VSTGIGCARPGLPGIYTRVSKYVSWM 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 68/264 (26%)
Tryp_SPc 67..297 CDD:214473 67/262 (26%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 68/274 (25%)
Tryp_SPc 35..280 CDD:238113 69/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.