DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG4914

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:311 Identity:92/311 - (29%)
Similarity:140/311 - (45%) Gaps:51/311 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKNWTINTFLLVSFLCSATGQNEGGAPGIFNGMSFTENLQPDPNQVCGMSNPNGLVANVKVPKDY 66
            :||| ...|            |...:|...|..|      |..:..||..|....:..      .
  Fly    92 IKNW-FGAF------------NRNNSPAAQNQTS------PTCSCRCGERNDESRIVG------G 131

  Fly    67 STPG--QFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPS 129
            :|.|  ::||:..|....:::..|:||....|||||..|.|.....|.|..||      .:....
  Fly   132 TTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGE------HDRCND 190

  Fly   130 EDRPVARVVQH---REFSYLLGANNIALLFLANPFELKSHIRTICLP---SQGRSFDQKRCLVTG 188
            ::||..|.|..   ::||:....|:||||.|.:...:.|.||.||||   .:...|...:.:.||
  Fly   191 KERPETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATG 255

  Fly   189 WGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAG----GEKDAGDCLG 249
            ||.:. .|...|.:.:::|:|:::..:|..|...|:..::    .:::|:|    |.:|:  |.|
  Fly   256 WGTLK-EDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMIT----KNMMCSGYPGVGGRDS--CQG 313

  Fly   250 DGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEH 300
            |.|..| ..:..|..|:||.|||:||.||...|.|.|||.|..:.|||.|:
  Fly   314 DSGGPL-VRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVEN 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 79/244 (32%)
Tryp_SPc 67..297 CDD:214473 77/241 (32%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 77/252 (31%)
Tryp_SPc 128..363 CDD:238113 79/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.