DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG4613

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:257 Identity:76/257 - (29%)
Similarity:123/257 - (47%) Gaps:30/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CGMSNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKTDAEIV 112
            ||:.|.|.:|...:|     ...::||:..:......|..|:||....|||||..|.|.....:.
  Fly   129 CGVPNVNRIVGGTQV-----RTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVS 188

  Fly   113 VRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQG- 176
            ||..:.:   ||.......|.||....|..:..:...::||||.|..|..|...:|..||||.. 
  Fly   189 VRLLQLD---RSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWL 250

  Fly   177 RSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFD--LPASLICAG 239
            ::||.::.:|.||| ::....:.|::.:::.:|:|..|||:        ..|:.  :..:::|||
  Fly   251 QNFDFQKAIVAGWG-LSQEGGSTSSVLQEVVVPIITNAQCR--------ATSYRSMIVDTMMCAG 306

  Fly   240 ----GEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWI 297
                |.:||  |.||.|.    |:......:..||:|::|.||.:.:.|.|||.|..:.:||
  Fly   307 YVKTGGRDA--CQGDSGG----PLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 70/238 (29%)
Tryp_SPc 67..297 CDD:214473 68/236 (29%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 70/248 (28%)
Tryp_SPc 137..362 CDD:238113 70/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.