DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG10663

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:314 Identity:83/314 - (26%)
Similarity:127/314 - (40%) Gaps:65/314 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GAPGIFNGMSFTENLQP-----DPNQV-----------------CG----------MSNPNGLVA 58
            |:|.  |.|...::.||     |.|.:                 ||          |||...::.
  Fly   447 GSPA--NAMRRMQSEQPEVSMNDLNYIMTGKGYRGPEYTPLKLSCGIVRSGTGRRSMSNMLKIIG 509

  Fly    59 NVKVPKDYSTPGQFPWVVALFSQGK-YFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQ 122
            .....|     |::||.||:.::.| .|..|:||||..|||||..|    ...:.||.||.|   
  Fly   510 GRAARK-----GEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCV----RKVLFVRIGEHN--- 562

  Fly   123 RSEFLPSEDRP-----VARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQK 182
                |..||..     |.:...|..|......:::|||.|.......:.|...|||...::..:.
  Fly   563 ----LNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKN 623

  Fly   183 -RCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGD 246
             .|.:.||||....|...:::..|..:|:|....|:      ::...:.:..::.|||.:|...|
  Fly   624 VDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCR------KVYYDYTITKNMFCAGHQKGHID 682

  Fly   247 -CLGDGGSALFCPMEADPSR-YEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIY 298
             |.||.|..|.|.....|:. :...||.::|.||.:.|...:|..|..:.||::
  Fly   683 TCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVW 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 69/241 (29%)
Tryp_SPc 67..297 CDD:214473 68/238 (29%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 69/250 (28%)
Tryp_SPc 507..735 CDD:238113 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.