DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG4477

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:257 Identity:66/257 - (25%)
Similarity:118/257 - (45%) Gaps:47/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 WVVALFSQG--KYFG-----AGSLIAPEVVLTAASIVVGK-----TDAEIVVRAGEWNTGQRSEF 126
            :.|:|.|:.  |:||     :|.::||..|:|:|..::.|     :...:::.||..|   |.::
  Fly    53 YCVSLRSRSAEKFFGDNHFCSGVILAPMFVMTSAHCLINKRRVLISSRVLLIVAGTLN---RLKY 114

  Fly   127 LPSED--RPVARVVQHREFSYLLGANNIALLFLANPFELKS-HIRTICLPSQGRSFDQKRCLVTG 188
            :|:..  .||..:.....|: :....:..||.:.|||...: ||....||.. ......:|.|.|
  Fly   115 IPNRTFVTPVTHIWLPDSFT-MRNKQDFGLLKVKNPFPRNNEHISIARLPVH-PPLPGLKCKVMG 177

  Fly   189 WGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPA-SLICAGGEKDAGD------ 246
            ||:: :.....::....|::.:|:...|...||         :|: ..:||   .|:.|      
  Fly   178 WGRM-YKGGPLASYMLYIDVQVIDSEACAKWLR---------VPSVEHVCA---VDSDDLTAQQP 229

  Fly   247 CLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHMAQNSNSV 308
            |.||.|:    ||..:.:.|   |||....||...::|::||||....:||:|.:..::.|:
  Fly   230 CGGDWGA----PMLHNGTVY---GIVTILAGCGVSHLPSLYTNVHSNANWIHEKIISSAGSI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 64/247 (26%)
Tryp_SPc 67..297 CDD:214473 62/244 (25%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 64/245 (26%)
Tryp_SPc 55..273 CDD:214473 62/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.