DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG30414

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:331 Identity:88/331 - (26%)
Similarity:121/331 - (36%) Gaps:93/331 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVSFLCSATGQNEGGAPGIFNGMSFTENLQPDPNQVCGMSNPN-----------GLVANVKVPKD 65
            |...:||.  |...||||.....|            ||.:.|.           ||.:|      
  Fly     8 LALLVCSI--QLGEGAPGHLLDSS------------CGTTKPEFIPMITGGADAGLFSN------ 52

  Fly    66 YSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNT---------- 120
                   ||:|.:.  |:....||||....|||||..:|   ...:.||.||:.|          
  Fly    53 -------PWMVKVL--GEKLCGGSLITSRFVLTAAHCIV---STHMRVRLGEYKTRFPGKDCSRC 105

  Fly   121 ------------GQRSEFLPSED--------RPVARVVQHREFSYLLGANNIALLFLANPFELKS 165
                        |:.....|.:|        ..|.|.:.|.:::..|. |:|.||.:.:..:...
  Fly   106 VPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADYNLNLD-NDIGLLRMKSFVQYSD 169

  Fly   166 HIRTICLPSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQD-QLRNTRLGVSF 229
            ::|.|||..:|...:.....:||||  ..||...|.        .:.||...: .|...|...:.
  Fly   170 YVRPICLLVEGHMAESPIFNITGWG--VTNDGTPSR--------RLQRATVYNTDLHFCRSKFTK 224

  Fly   230 DLPASLICAGG-EKDAGDCLGDGGSALFCPMEADPSRYE-QAGIVNWG-IGCQEENVPAVYTNVE 291
            .:..|.|||.| ..||  |.||.|..|...:....|... |.|:|::| ..|...   :|||||.
  Fly   225 QVDESQICAAGTNSDA--CHGDSGGPLSAQVPFAGSWLTFQYGLVSYGSAACHSF---SVYTNVT 284

  Fly   292 MFRDWI 297
            ..||||
  Fly   285 HHRDWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 73/265 (28%)
Tryp_SPc 67..297 CDD:214473 71/263 (27%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 74/282 (26%)
Tryp_SPc 41..290 CDD:238113 74/282 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.