DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG9294

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:282 Identity:81/282 - (28%)
Similarity:138/282 - (48%) Gaps:40/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VANVKVPKD------------YSTPG-------QFPWVVALFSQGKYFGAGSLIAPEVVLTAASI 102
            |||..:.:|            |...|       |:||:..:....:::.:||||....|||||..
  Fly    78 VANFPIERDCVTCRCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHC 142

  Fly   103 VVGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSH- 166
            |.|.....|.:|..|.|....::.:..: |.|:||..|..::.....|::|:|.|..|.:::.| 
  Fly   143 VEGVPPELITLRFLEHNRSHSNDDIVIQ-RYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHR 206

  Fly   167 IRTICLPSQGRSFDQKRCLVTGWGKVAFNDENY-SNIQKKIELPMINRAQCQDQLRNTRLGVSF- 229
            :|.||||.|..|||.:..:|.|||  |..:..: ::..:::::.::.:::|       |.|.:: 
  Fly   207 LRPICLPVQSYSFDHELGIVAGWG--AQREGGFGTDTLREVDVVVLPQSEC-------RNGTTYR 262

  Fly   230 --DLPASLICAG----GEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYT 288
              .:..:::|||    |.|||  |.||.|..|....:..|.:|:.||||:||:||.....|.|||
  Fly   263 PGQITDNMMCAGYISEGGKDA--CSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYT 325

  Fly   289 NVEMFRDWIYEHMAQNSNSVPF 310
            .|..:..|:..:.....:.:|:
  Fly   326 RVNQYLRWLGSNTPGGCHCMPY 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 75/248 (30%)
Tryp_SPc 67..297 CDD:214473 74/245 (30%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 74/244 (30%)
Tryp_SPc 101..334 CDD:238113 74/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.