DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and tpr

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:310 Identity:88/310 - (28%)
Similarity:146/310 - (47%) Gaps:32/310 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KNWTINTFLLVSFLCSATGQNEGGAPGIFNGMSFTE--------NLQPDPN---QVCGMSNPNGL 56
            :|.|:.|....|.:..|........|...:..:.|.        .|.|..|   .|||::|....
  Fly    62 ENATLATLSSSSMMPDAASTTSTTTPAPSSSTTTTRRATTPAPPTLNPPRNCSDCVCGIANIQKR 126

  Fly    57 VANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTG 121
            :...:..:.:    |:|||..|...|:::.|.||:..:.:|||:..|.|.....|.||..|.:  
  Fly   127 IVGGQETEVH----QYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHD-- 185

  Fly   122 QRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQKRCLV 186
            ::...:...||.||.|:.|.:::.....|:||::.|..|.|....:..:|:|:.||||..:..:|
  Fly   186 RKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGIV 250

  Fly   187 TGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAG---GEKDAGDCL 248
            ||||.:.........:| ::::|:::    ||:.|.:|.|..  :..:::|.|   |.||:  |.
  Fly   251 TGWGALKVGGPTSDTLQ-EVQVPILS----QDECRKSRYGNK--ITDNMLCGGYDEGGKDS--CQ 306

  Fly   249 GDGGSALFCPMEADPSRYEQ-AGIVNWGIGCQEENVPAVYTNVEMFRDWI 297
            ||.|..|.  :.|..:|..| ||:|:||.||.:...|.||..|..:..||
  Fly   307 GDSGGPLH--IVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 74/235 (31%)
Tryp_SPc 67..297 CDD:214473 72/233 (31%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 72/244 (30%)
Tryp_SPc 127..356 CDD:238113 74/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.