DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG8172

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:299 Identity:91/299 - (30%)
Similarity:139/299 - (46%) Gaps:30/299 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ATGQNEGGAPGIFNGMSFTENLQPDPNQVCG--MSNPNGLVANVKVPKDYSTP-GQFPWVVALFS 80
            |..:.:.|..|.::..|:    :|.|.  ||  .:..|.:|..      :||. |..||.|||..
  Fly   283 AADEYQSGGSGGYHDASY----RPVPG--CGEVYTRSNRIVGG------HSTGFGSHPWQVALIK 335

  Fly    81 QG----KYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHR 141
            .|    |....|:||:...|:|||..|....::.:.:|.|||:...:.|.|..|:..:.|...|.
  Fly   336 SGFLTRKLSCGGALISNRWVITAAHCVASTPNSNMKIRLGEWDVRGQEERLNHEEYGIERKEVHP 400

  Fly   142 EFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKI 206
            .::.....|::||:.|......|.||..:|||........|...|.|||:.........::.:::
  Fly   401 HYNPADFVNDVALIRLDRNVVYKQHIIPVCLPPSTTKLTGKMATVAGWGRTRHGQSTVPSVLQEV 465

  Fly   207 ELPMINRAQCQDQLRNT-RLGVSFDLPASLICAGGEKDAG--DCLGDGGSALFCPMEADPSRYEQ 268
            ::.:|:..:||...|.. |.....|:   .:|| |.||.|  .|.||.|..|...|:   .|...
  Fly   466 DVEVISNDRCQRWFRAAGRREAIHDV---FLCA-GYKDGGRDSCQGDSGGPLTLTMD---GRKTL 523

  Fly   269 AGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHMAQNSNS 307
            .|:|:|||||..|::|.||||::.|..||.:.|| |.|:
  Fly   524 IGLVSWGIGCGREHLPGVYTNIQRFVPWINKVMA-NDNA 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 77/240 (32%)
Tryp_SPc 67..297 CDD:214473 75/237 (32%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 76/249 (31%)
Tryp_SPc 316..555 CDD:238113 78/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457550
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.