DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG8586

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:264 Identity:106/264 - (40%)
Similarity:148/264 - (56%) Gaps:15/264 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CGMSNPNGLVA-NVKVP--KDYSTPGQFPWVVALFS-QGKYFGAGSLIAPEVVLTAASIVVGKTD 108
            ||.|||.||:. |.|.|  :|.|..|:|||:|.:|: :.::...|:||.|.:|:|.:..:|.:|.
  Fly   172 CGYSNPKGLIPDNDKFPYSEDVSIFGEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNLVNETV 236

  Fly   109 AEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLP 173
            ..:|.|||:|:....:|..|.:...:..::.|.||......|:||||.|..|..|..||:.:|||
  Fly   237 DTLVARAGDWDLNSLNEPYPHQGSRIKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLP 301

  Fly   174 --------SQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFD 230
                    :|..|.   .|..||||......:...::.|:|.||::.|.:||.:||||||...|.
  Fly   302 PPESPELTNQLLSV---TCYATGWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFR 363

  Fly   231 LPASLICAGGEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRD 295
            |..|.|||||:.....|.|||||.|||.|..:..||:..|||:||:.|..|::||||.||...|.
  Fly   364 LRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRG 428

  Fly   296 WIYE 299
            ||.|
  Fly   429 WIDE 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 95/242 (39%)
Tryp_SPc 67..297 CDD:214473 92/238 (39%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 94/239 (39%)
Tryp_SPc 197..430 CDD:214473 91/235 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457415
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.