DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG18563

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster


Alignment Length:264 Identity:115/264 - (43%)
Similarity:159/264 - (60%) Gaps:15/264 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QPDPNQVCGMSNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVG 105
            ||.|.:   .:.|.|..         :|.|.:.||||||.:..|...||||:|:|:||||...:.
  Fly   126 QPKPTE---RTQPGGRC---------NTTGLYSWVVALFYEEVYLTGGSLISPKVILTAAHNTMN 178

  Fly   106 KTDAE-IVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRT 169
            |.:.: |||||||:.....:|.:..|:|.|.|:|:|..|.:..|.||:||:|:..||.|...|..
  Fly   179 KMNEDRIVVRAGEFVMNTTNEPIQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGV 243

  Fly   170 ICLPSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPAS 234
            :.|||:..||:.:||.|.||..|:.:|::...|.||:||.:::|..|..|.|||.||.:|||..|
  Fly   244 LTLPSRQASFEGRRCTVAGWDLVSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLHPS 308

  Fly   235 LICAGGEKDAGDCLGDGGSALFCPM-EADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIY 298
            ||||..|.:...|.|.||.||||.: :.:|..:||||||.||:||..: :|.:||||.|||.|||
  Fly   309 LICARSEINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAWGMGCGLD-LPGIYTNVAMFRSWIY 372

  Fly   299 EHMA 302
            ..:|
  Fly   373 NRIA 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 109/234 (47%)
Tryp_SPc 67..297 CDD:214473 106/231 (46%)
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 106/226 (47%)
Tryp_SPc 147..371 CDD:214473 104/224 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471495
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.