DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and SPH93

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:299 Identity:143/299 - (47%)
Similarity:183/299 - (61%) Gaps:21/299 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NEGGAPGIFNGMSFTENLQPDPNQVCGMSNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGA 87
            |.||.|....|.|  |.|.|.    |||||.|||.....:..|.:.|.|:||.||:|..|:|...
  Fly   214 NNGGNPTTNVGSS--ELLSPS----CGMSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAG 272

  Fly    88 GSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNI 152
            ||||.|.||||.|..|: ..:.|:|||||:|:.....|...||.|.|.|.|.|..|.:..||||:
  Fly   273 GSLIQPNVVLTVAHRVI-TIETELVVRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNL 336

  Fly   153 ALLFLANPFELKSHIRTICLPSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQ 217
            |||||.:||:|..||||||||:..:||..:||.|.||||:.:.|:.||.:.||::|.::||..|:
  Fly   337 ALLFLNSPFKLNDHIRTICLPTPNKSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCE 401

  Fly   218 DQLRNTRLGVSFDLPASLICAGGEKDAGDCLGDGGSALFCPMEADPSR-YEQAGIVNWGIGCQEE 281
            ..||:||||..|:||.::||||||.....|.|||||||||.:..:.|. ||||||||||:||.:|
  Fly   402 KFLRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQE 466

  Fly   282 NVPAVYTNVEMFRDWIYEHMAQNSNSVPFAAGQLPSNYK 320
            .:||:||.|..|.:||.|.:             ||.:|:
  Fly   467 GIPAIYTEVSKFTNWITEKL-------------LPFDYR 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 121/233 (52%)
Tryp_SPc 67..297 CDD:214473 119/230 (52%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 122/235 (52%)
Tryp_SPc 252..482 CDD:214473 119/230 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471496
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.