DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG9377

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:234 Identity:74/234 - (31%)
Similarity:122/234 - (52%) Gaps:10/234 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPSEDRPV 134
            |:|||:||::....|..:|:||.|..|:|.|..|......::.:.||||:.....|..|.:.|.|
  Fly   110 GEFPWLVAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSV 174

  Fly   135 ARVVQHREFSYLLGANNIALLFL--ANPFELKSHIRTICLPSQGRSFDQKRCLVTGWGKVAFNDE 197
            ...:.|..::.:..|:|||:|.:  ..||:|..:::.||||.....::..:|.|:||.:..|.  
  Fly   175 VETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQCYVSGWQRSDFG-- 237

  Fly   198 NYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCL-GD---GGSALFCP 258
            ..:.:.|:..|.::...||:.:||.:.||.......||:||||:|  ||.: ||   ....|.||
  Fly   238 RAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDK--GDFVCGDVDMTAVPLMCP 300

  Fly   259 MEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWI 297
            :.....|:..||::.....|....:..:||||:::|.||
  Fly   301 LSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 74/234 (32%)
Tryp_SPc 67..297 CDD:214473 72/232 (31%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 74/234 (32%)
Tryp_SPc 105..339 CDD:214473 72/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.