DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:268 Identity:92/268 - (34%)
Similarity:132/268 - (49%) Gaps:30/268 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CGMSNP-----NGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKT 107
            ||..||     ..:|..:.     ::|.:|||:..||..||.|..||||....:||||..|...|
  Fly   387 CGNKNPVTPDQERIVGGIN-----ASPHEFPWIAVLFKSGKQFCGGSLITNSHILTAAHCVARMT 446

  Fly   108 D---AEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRT 169
            .   |.:....|::|.|...| :....|.:.|:|:|:.|.:....|::|:|.|:.|......|:.
  Fly   447 SWDVAALTAHLGDYNIGTDFE-VQHVSRRIKRLVRHKGFEFSTLHNDVAILTLSEPVPFTREIQP 510

  Fly   170 ICLPS----QGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFD 230
            ||||:    |.||:..:...|.|||.:..|....|.:| |:::|:...|:|..:......|   .
  Fly   511 ICLPTSPSQQSRSYSGQVATVAGWGSLRENGPQPSILQ-KVDIPIWTNAECARKYGRAAPG---G 571

  Fly   231 LPASLICAG-GEKDAGDCLGDGGSALFCPMEA-DPSRYEQAGIVNWGIGCQEENVPAVYTNVEMF 293
            :..|:|||| ..||:  |.||.|.    ||.. |..||.|.|||:|||||.:...|.|||.|...
  Fly   572 IIESMICAGQAAKDS--CSGDSGG----PMVINDGGRYTQVGIVSWGIGCGKGQYPGVYTRVTSL 630

  Fly   294 RDWIYEHM 301
            ..|||:::
  Fly   631 LPWIYKNI 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 87/241 (36%)
Tryp_SPc 67..297 CDD:214473 84/238 (35%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 85/250 (34%)
Tryp_SPc 400..637 CDD:238113 88/252 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.