DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and PRSS48

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:305 Identity:87/305 - (28%)
Similarity:142/305 - (46%) Gaps:51/305 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GQNEGGAPGIFNGMSFTENLQPDPNQVCGMSNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKYF 85
            |..|.|..|....:|       ..:.|||..    :.::..|....:..|::||.|:|.....:.
Human    22 GTRETGLLGFHISLS-------SLSLVCGQP----VYSSRVVGGQDAAAGRWPWQVSLHFDHNFI 75

  Fly    86 GAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPS----EDRP-----VARVVQHR 141
            ..|||::..::||||..:           ...|.|...:.:|.|    :.|.     |:::|.|.
Human    76 CGGSLVSERLILTAAHCI-----------QPTWTTFSYTVWLGSITVGDSRKRVKYYVSKIVIHP 129

  Fly   142 EFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFD-QKRCLVTGWGKV-AFNDENYSNIQK 204
            ::.....  ::|||.|::.....|.|..|||||..:... ...|.||||||| ..:|.:|.:..:
Human   130 KYQDTTA--DVALLKLSSQVTFTSAILPICLPSVTKQLAIPPFCWVTGWGKVKESSDRDYHSALQ 192

  Fly   205 KIELPMINRAQCQDQLRNTRLGVSFDLPA-------SLICAGGEKDAGD-CLGDGGSALFCPMEA 261
            :.|:|:|:|..| :||.|.   :...|||       ..||||..::..| |.||.|..|.|.:: 
Human   193 EAEVPIIDRQAC-EQLYNP---IGIFLPALEPVIKEDKICAGDTQNMKDSCKGDSGGPLSCHID- 252

  Fly   262 DPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHMAQNSN 306
              ..:.|.|:|:||:.| .:::|.|||||..::.||...:::.:|
Human   253 --GVWIQTGVVSWGLEC-GKSLPGVYTNVIYYQKWINATISRANN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 77/251 (31%)
Tryp_SPc 67..297 CDD:214473 75/248 (30%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 76/255 (30%)
Tryp_SPc 51..288 CDD:238113 78/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.