DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG3355

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:265 Identity:89/265 - (33%)
Similarity:127/265 - (47%) Gaps:29/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NQVCGMSNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKY---FGAGSLIAPEVVLTAASIVVGK 106
            |..||..|.|.:|...:|..:     ::||...|.....|   |..||||....|||||..|.|.
  Fly    65 NCFCGTPNVNRIVGGQQVRSN-----KYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGN 124

  Fly   107 TDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTIC 171
            .| :|.:|..:.:...|.   |...|.|.:...|..:......|::|||.|.:|..|..::|.:|
  Fly   125 RD-QITIRLLQIDRSSRD---PGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVC 185

  Fly   172 LPSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLI 236
            ||....:||.|..:|.|||.:...... ||..:::.:|:|..|||    |.||  ....:...::
  Fly   186 LPEANHNFDGKTAVVAGWGLIKEGGVT-SNYLQEVNVPVITNAQC----RQTR--YKDKIAEVML 243

  Fly   237 CAG----GEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWI 297
            |||    |.|||  |.||.|.    |:..:..||:.||:|::|.||.::|.|.||..|..|.|||
  Fly   244 CAGLVQQGGKDA--CQGDSGG----PLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302

  Fly   298 YEHMA 302
            .::.|
  Fly   303 RKNTA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 81/239 (34%)
Tryp_SPc 67..297 CDD:214473 79/236 (33%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 81/248 (33%)
Tryp_SPc 76..305 CDD:238113 83/250 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457670
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.